Proteintech, 67753-1-Ig, VASH2 Monoclonal antibody

Size: 20ul / 150ul The VASH2 (67753-1-Ig) by Proteintech is a Monoclonal antibody targeting VASH2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67753-1-Ig targets VASH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, BGC-823 cells, L02 cells, HepG2 cells, HUVEC cells, HSC-T6 cells, NIH/3T3 cells, SGC-7901 cells, MKN-45 cells Positive IHC detected in: human skin cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information VASH2, also named as vasohibin 2, is an important pro-angiogenesis factor in solid tumor. It has been reported that VASH2 is expressed in mononuclear cells mobilized from bone marrow to promote angiogenesis. VASH2 also plays a key role in axon formation. VASH2 is localized as a nuclear type(with 311 amino acid residues) and cytoplasmic type (with 355 amino acid residues and low abundance). Cytoplasmic VASH2 is associated with carcinoma angiogenesis, while nuclear VASH2 may be associated with cell proliferation. 67753-1-Ig antibody recognizes both the nuclear and cytoplasmic isoforms. (PMID:23615928; 19204325; 31235911; 26177649) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29985 Product name: Recombinant human VASH2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-156 aa of BC028194 Sequence: METAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKGLCSH Predict reactive species Full Name: vasohibin 2 Calculated Molecular Weight: 355 aa, 40 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC028194 Gene Symbol: VASH2 Gene ID (NCBI): 79805 RRID: AB_2918521 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86V25 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.