Iright
BRAND / VENDOR: Proteintech

Proteintech, 67774-1-Ig, KLHL25 Monoclonal antibody

CATALOG NUMBER: 67774-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KLHL25 (67774-1-Ig) by Proteintech is a Monoclonal antibody targeting KLHL25 in WB, IHC, ELISA applications with reactivity to human, mouse samples 67774-1-Ig targets KLHL25 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HT-29 cells, HepG2 cells, NCCIT cells, MOLT-4 cells, Raji cells, Ramos cells, Daudi cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27037 Product name: Recombinant human KLHL25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-260 aa of BC028100 Sequence: RRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADE Predict reactive species Full Name: kelch-like 25 (Drosophila) Observed Molecular Weight: 66 kDa GenBank Accession Number: BC028100 Gene Symbol: KLHL25 Gene ID (NCBI): 64410 RRID: AB_2918539 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H0H3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924