Iright
BRAND / VENDOR: Proteintech

Proteintech, 67786-1-Ig, CD4 Monoclonal antibody

CATALOG NUMBER: 67786-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD4 (67786-1-Ig) by Proteintech is a Monoclonal antibody targeting CD4 in IHC, IF-P, ELISA applications with reactivity to human samples 67786-1-Ig targets CD4 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human colon tissue, human liver tissue, human thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:450-1:1800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells (PMID: 9304802; 12213222). CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation (PMID: 9539765; 3112582). CD4 serves as a receptor for the human immunodeficiency virus (HIV) (PMID: 9304802). Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30870 Product name: Recombinant human CD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-226 aa of BC025782 Sequence: KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLA Predict reactive species Full Name: CD4 molecule Calculated Molecular Weight: 55 kDa GenBank Accession Number: BC025782 Gene Symbol: CD4 Gene ID (NCBI): 920 ENSEMBL Gene ID: ENSG00000010610 RRID: AB_2918550 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P01730 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924