Iright
BRAND / VENDOR: Proteintech

Proteintech, 67809-1-Ig, PPP2CA Monoclonal antibody

CATALOG NUMBER: 67809-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP2CA (67809-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP2CA in WB, IHC, ELISA applications with reactivity to Human, rat samples 67809-1-Ig targets PPP2CA in WB, IHC, CoIP, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: A549 cells, U2OS cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future. Specification Tested Reactivity: Human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4294 Product name: Recombinant human PPP2CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-309 aa of BC031696 Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL Predict reactive species Full Name: protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform Calculated Molecular Weight: 309 aa, 36 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC031696 Gene Symbol: PPP2CA Gene ID (NCBI): 5515 RRID: AB_2918572 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P67775 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924