Iright
BRAND / VENDOR: Proteintech

Proteintech, 67816-1-Ig, TALDO1 Monoclonal antibody

CATALOG NUMBER: 67816-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TALDO1 (67816-1-Ig) by Proteintech is a Monoclonal antibody targeting TALDO1 in WB, IHC, ELISA applications with reactivity to Human samples 67816-1-Ig targets TALDO1 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, Jurkat cells, K-562 cells Positive IHC detected in: human oesophagus cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information TALDO1 belongs to the transaldolase family which contributes to the generation of NADPH in the nonoxidative phase of the pentose phosphate pathway (PPP). Defects in TALDO1 are the cause of transaldolase 1 deficiency which results in telangiectases of the skin, hepatosplenomegaly, and enlarged clitoris. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3031 Product name: Recombinant human TALDO1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-277 aa of BC009680 Sequence: MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAK Predict reactive species Full Name: transaldolase 1 Calculated Molecular Weight: 337 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC009680 Gene Symbol: TALDO1 Gene ID (NCBI): 6888 RRID: AB_2918579 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P37837 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924