Iright
BRAND / VENDOR: Proteintech

Proteintech, 67821-1-Ig, PPARGC1B Monoclonal antibody

CATALOG NUMBER: 67821-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPARGC1B (67821-1-Ig) by Proteintech is a Monoclonal antibody targeting PPARGC1B in WB, ELISA applications with reactivity to Human, mouse, pig, rat samples 67821-1-Ig targets PPARGC1B in WB, ELISA applications and shows reactivity with Human, mouse, pig, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, SH-SY5Y cells, pig brain tissue, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, mouse, pig, rat Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28861 Product name: Recombinant human PPARGC1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC132971 Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD Predict reactive species Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta Calculated Molecular Weight: 1023 aa, 113 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC132971 Gene Symbol: PPARGC1B Gene ID (NCBI): 133522 RRID: AB_2918584 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86YN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924