Iright
BRAND / VENDOR: Proteintech

Proteintech, 67842-1-Ig, DOCK7 Monoclonal antibody

CATALOG NUMBER: 67842-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DOCK7 (67842-1-Ig) by Proteintech is a Monoclonal antibody targeting DOCK7 in WB, ELISA applications with reactivity to Human, mouse, rat samples 67842-1-Ig targets DOCK7 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, PC-12 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, NIH3T3 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information DOCK 7 (dedicator of cytokinesis 7), also known as ZIR2, is a member of the DOCK180-related protein superfamily. Expressed mainly in neuronal cells, DOCK 7 is a guanine nucleotide exchange factor (GEF) for small GTPases, Rac1 and Cdc42, which are the major regulators of actin cytoskeleton. Multiple isoforms of DOCK 7 exist due to alternative splicing events. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28417 Product name: Recombinant human DOCK7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 447-798 aa of BC016392 Sequence: MAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL Predict reactive species Full Name: dedicator of cytokinesis 7 Calculated Molecular Weight: 2109 aa, 239 kDa Observed Molecular Weight: 243 kDa GenBank Accession Number: BC016392 Gene Symbol: DOCK7 Gene ID (NCBI): 85440 RRID: AB_2918604 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96N67 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924