Iright
BRAND / VENDOR: Proteintech

Proteintech, 67846-1-Ig, MGLL Monoclonal antibody

CATALOG NUMBER: 67846-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MGLL (67846-1-Ig) by Proteintech is a Monoclonal antibody targeting MGLL in WB, ELISA applications with reactivity to Human, pig samples 67846-1-Ig targets MGLL in WB, ELISA applications and shows reactivity with Human, pig samples. Tested Applications Positive WB detected in: THP-1 cells, A549 cells, HeLa cells, human platelets tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MGLL (monoglyceride lipase) is also named as MAGL, HU-K5 and belongs to the monoacylglycerol lipase family. It converts monoacylglycerides to free fatty acids and glycerol and functions together with hormone-sensitive lipase (HSL) in the mobilization of fatty acids from the triglyceride stores of adipocytes. MGL protein is ubiquitously expressed in kidney, spleen, heart, liver, stomach, brain, lung, adrenal gland, adipose tissue and in brain,there are two bands of 33 kDa and 35 kDa can be detected. The single protein species expressed in muscle is larger (around 40 kDa) (PMID:11470505). This protein can exsit as a homodimer (PMID:19957260). Specification Tested Reactivity: Human, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7052 Product name: Recombinant human MGLL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-313 aa of BC000551 Sequence: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP Predict reactive species Full Name: monoglyceride lipase Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC000551 Gene Symbol: MGLL Gene ID (NCBI): 11343 RRID: AB_2918608 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99685 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924