Proteintech, 67858-1-Ig, GIT2 Monoclonal antibody

Size: 20ul / 150ul The GIT2 (67858-1-Ig) by Proteintech is a Monoclonal antibody targeting GIT2 in WB, IHC, ELISA applications with reactivity to Human, rat samples 67858-1-Ig targets GIT2 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: A549 cells, K-562 cells, HSC-T6 cells, HEK-293 cells, HeLa cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: Human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0321 Product name: Recombinant human GIT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-462 aa of BC001379 Sequence: DSSLDLSELAKAAKKKLQSLSNHLFEELAMDMYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDLSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQ Predict reactive species Full Name: G protein-coupled receptor kinase interacting ArfGAP 2 Calculated Molecular Weight: 95 kDa Observed Molecular Weight: 70-85 kDa GenBank Accession Number: BC001379 Gene Symbol: GIT2 Gene ID (NCBI): 9815 RRID: AB_2918616 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14161 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.