Iright
BRAND / VENDOR: Proteintech

Proteintech, 67859-1-Ig, ASH2L Monoclonal antibody

CATALOG NUMBER: 67859-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ASH2L (67859-1-Ig) by Proteintech is a Monoclonal antibody targeting ASH2L in WB, IHC, FC (Intra), ELISA applications with reactivity to human, rat samples 67859-1-Ig targets ASH2L in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HSC-T6 cells, HeLa cells, HEK-293 cells, PC-12 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3008 Product name: Recombinant human ASH2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-534 aa of BC015936 Sequence: HGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP Predict reactive species Full Name: ash2 (absent, small, or homeotic)-like (Drosophila) Calculated Molecular Weight: 628 aa, 69 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC015936 Gene Symbol: ASH2L Gene ID (NCBI): 9070 RRID: AB_2918617 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UBL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924