Iright
BRAND / VENDOR: Proteintech

Proteintech, 67862-1-Ig, GSTM1 Monoclonal antibody

CATALOG NUMBER: 67862-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSTM1 (67862-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTM1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, chicken samples 67862-1-Ig targets GSTM1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, chicken samples. Tested Applications Positive WB detected in: rat liver tissue, chicken liver tissue, HeLa cells, Jurkat cells, mouse liver tissue, pig liver tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat, pig, chicken Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3113 Product name: Recombinant human GSTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC024005 Sequence: MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK Predict reactive species Full Name: glutathione S-transferase mu 1 Calculated Molecular Weight: 181 aa, 21 kDa Observed Molecular Weight: 26-28 kDa GenBank Accession Number: BC024005 Gene Symbol: GSTM1 Gene ID (NCBI): 2944 RRID: AB_2918620 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924