Iright
BRAND / VENDOR: Proteintech

Proteintech, 67868-1-Ig, AATF Monoclonal antibody

CATALOG NUMBER: 67868-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AATF (67868-1-Ig) by Proteintech is a Monoclonal antibody targeting AATF in WB, ELISA, FC (Intra) applications with reactivity to Human, mouse, rat samples 67868-1-Ig targets AATF in WB, IHC, ELISA, FC (Intra) applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, Neuro-2a cells, HepG2 cells, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0195 Product name: Recombinant human AATF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-212 aa of BC000591 Sequence: LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTF Predict reactive species Full Name: apoptosis antagonizing transcription factor Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC000591 Gene Symbol: AATF Gene ID (NCBI): 26574 RRID: AB_2918626 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NY61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924