Iright
BRAND / VENDOR: Proteintech

Proteintech, 67879-1-Ig, DAXX Monoclonal antibody

CATALOG NUMBER: 67879-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DAXX (67879-1-Ig) by Proteintech is a Monoclonal antibody targeting DAXX in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 67879-1-Ig targets DAXX in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Raji cells, HeLa cells, Daudi cells, MOLT-4 cells, Jurkat cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Death domain-associated protein (DAXX) is a transcription repressor involved in both physiological and pathological conditions. DAXX overexpression is a common feature in diverse cancers, which correlates with tumorigenesis, disease progression and treatment resistance. Daxx migrated with an apparent molecular weight of approximately 100-130 kDa. (PMID: 31350900, PMID: 32203224, PMID: 31614769) Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14606 Product name: Recombinant human DAXX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-349 aa of BC109074 Sequence: MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVD Predict reactive species Full Name: death-domain associated protein Calculated Molecular Weight: 740 aa, 81 kDa Observed Molecular Weight: 100-130 kDa GenBank Accession Number: BC109074 Gene Symbol: DAXX Gene ID (NCBI): 1616 RRID: AB_2918636 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UER7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924