Proteintech, 67882-1-Ig, LPCAT3 Monoclonal antibody

Size: 20ul / 150ul The LPCAT3 (67882-1-Ig) by Proteintech is a Monoclonal antibody targeting LPCAT3 in WB, IHC, ELISA applications with reactivity to human, pig samples 67882-1-Ig targets LPCAT3 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig stomach tissue, HepG2 cells Positive IHC detected in: human stomach tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information Lysophosphatidylcholine acyltransferases (LPCATs) are among the lysophopholipid acyltransferases (LPLATs) that play an important role in lipid metabolism and homeostasis by regulating the abundance of different phosphatidylcholine (PC) species. Lysophosphatidylcholine acyltransferase 3 (LPCAT3) is a member of the LPCAT family that primarily regulates the levels of arachidonic PC species. LPCAT3 is abundantly expressed in the testes, kidneys, and metabolic tissues, including the liver, intestine, and adipose tissues. LPCAT3 is involved in the occurrence and development of atherosclerosis, intestinal tumors, and nonalcoholic steatohepatitis (NASH)(PMID: 35711841). Specification Tested Reactivity: human, pig Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6472 Product name: Recombinant human LPCAT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 122-233 aa of BC065194 Sequence: MAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKR Predict reactive species Full Name: lysophosphatidylcholine acyltransferase 3 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC065194 Gene Symbol: LPCAT3 Gene ID (NCBI): 10162 RRID: AB_2918639 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6P1A2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.