Iright
BRAND / VENDOR: Proteintech

Proteintech, 67884-1-Ig, ADC Monoclonal antibody

CATALOG NUMBER: 67884-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADC (67884-1-Ig) by Proteintech is a Monoclonal antibody targeting ADC in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67884-1-Ig targets ADC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, mouse brain tissue, mouse cerebellum tissue, rat cerebellum tissue, HEK-293 cells, pig brain tissue Positive IHC detected in: rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Antizyme inhibitor 2 (AZIN2) is a member of the antizyme inhibitor family, witch is able to bind to AZs and inhibit their action on both ODC activity and polyamine uptake. AZIN2 is predominantly expressed in the brain and testis and localized in the endoplasmic reticulum-golgi intermediate compartment. Available data suggest its role in cell growth, spermiogenesis, vesicular trafficking and secretion. Accumulation of azin2 has also been observed in brains of patients with Alzheimer's disease (PMID: 19832840) . AZIN2 has 5 described insoforms produced by alternative splicing. The molecular weight of AZIN2 is about 50 kDa. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31049 Product name: Recombinant human ADC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 251-460 aa of BC028128 Sequence: EIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRRQLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM Predict reactive species Full Name: arginine decarboxylase Calculated Molecular Weight: 460 aa, 50 kDa Observed Molecular Weight: 48-50 kDa GenBank Accession Number: BC028128 Gene Symbol: ADC Gene ID (NCBI): 113451 RRID: AB_2918641 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96A70 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924