Proteintech, 67896-1-Ig, SLC25A36 Monoclonal antibody

Size: 20ul / 150ul The SLC25A36 (67896-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC25A36 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67896-1-Ig targets SLC25A36 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23894 Product name: Recombinant human SLC25A36 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 97-184 aa of BC014064 Sequence: IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY Predict reactive species Full Name: solute carrier family 25, member 36 GenBank Accession Number: BC014064 Gene Symbol: SLC25A36 Gene ID (NCBI): 55186 RRID: AB_2918652 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96CQ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.