Iright
BRAND / VENDOR: Proteintech

Proteintech, 67903-1-Ig, MRPS25 Monoclonal antibody

CATALOG NUMBER: 67903-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPS25 (67903-1-Ig) by Proteintech is a Monoclonal antibody targeting MRPS25 in WB, ELISA applications with reactivity to Human, mouse, rat samples 67903-1-Ig targets MRPS25 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Mitochondrial ribosomal protein S25 (MRPS25) belongs to the ribosomal protein S25/L51 family. It is a component of the mitochondrial ribosome small subunit (28S). The variant segregated with the disease and substitutes a highly conserved proline residue with leucine (p.P72L) that, based on the high-resolution structure of the 28S ribosome, is predicted to compromise inter-protein contacts and destabilize the small subunit. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7846 Product name: Recombinant human MRPS25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-173 aa of BC003590 Sequence: MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD Predict reactive species Full Name: mitochondrial ribosomal protein S25 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC003590 Gene Symbol: MRPS25 Gene ID (NCBI): 64432 RRID: AB_2918659 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P82663 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924