Iright
BRAND / VENDOR: Proteintech

Proteintech, 67913-1-Ig, OSBPL5 Monoclonal antibody

CATALOG NUMBER: 67913-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OSBPL5 (67913-1-Ig) by Proteintech is a Monoclonal antibody targeting OSBPL5 in WB, ELISA applications with reactivity to human, mouse samples 67913-1-Ig targets OSBPL5 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U2OS cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11554 Product name: Recombinant human OSBPL5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-353 aa of BC032646 Sequence: MKEEAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNGPSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETLKAQKENYRQEKKRATRQLLSALTDPSVVIMADSLKGPKGESVGSITQPLPSSYLIFRAASESDGRCWLDALELALRCSSLLRLGTCKPGRDGEPGTSPDASPSSLCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEELGELGEASQVETVSEENKSLMWTLLKQLRPGMDLSRVVLPTFVLEPRSFLNKLSDYYYHADLLSRAAVEED Predict reactive species Full Name: oxysterol binding protein-like 5 Calculated Molecular Weight: 811 aa, 91 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC032646 Gene Symbol: OSBPL5 Gene ID (NCBI): 114879 RRID: AB_3085041 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H0X9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924