Iright
BRAND / VENDOR: Proteintech

Proteintech, 67926-1-Ig, FAM114A1 Monoclonal antibody

CATALOG NUMBER: 67926-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM114A1 (67926-1-Ig) by Proteintech is a Monoclonal antibody targeting FAM114A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, rat, mouse samples 67926-1-Ig targets FAM114A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: U2OS cells, PC-12 cells, NIH/3T3 cells, A549 cells, HepG2 cells, LNCaP cells, HeLa cells, HSC-T6 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FAM114A1, also named as Nervous system overexpressed protein 20, is a 563 amino acid protein, which belongs to the FAM114 family. FAM114A1 localizes in the cytoplasm and may play a role in neuronal cell development. The calculated molecular weight of FAM114A1 is 61 kDa, but the modified FAM114A1 may be 70-80 kDa protein. Specification Tested Reactivity: Human, rat, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17289 Product name: Recombinant human FAM114A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 305-538 aa of BC040452 Sequence: LEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENEENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLTTAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYI Predict reactive species Full Name: family with sequence similarity 114, member A1 Calculated Molecular Weight: 563 aa, 61 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC040452 Gene Symbol: FAM114A1 Gene ID (NCBI): 92689 RRID: AB_2918678 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IWE2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924