Product Description
Size: 20ul / 150ul
The SLC36A3 (67929-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC36A3 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse samples
67929-1-Ig targets SLC36A3 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse samples.
Tested Applications
Positive WB detected in: unboiled mouse testis tissue, COLO 320 cells
Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse testis tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Specification
Tested Reactivity: Human, Mouse
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag16556 Product name: Recombinant human SLC36A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 84-190 aa of BC101092 Sequence: VLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAVWGRWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYRYTVSFLLVITQLGF Predict reactive species
Full Name: solute carrier family 36 (proton/amino acid symporter), member 3
Calculated Molecular Weight: 511 aa, 56 kDa
Observed Molecular Weight: 51 kDa
GenBank Accession Number: BC101092
Gene Symbol: SLC36A3
Gene ID (NCBI): 285641
RRID: AB_2918681
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q495N2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924