Proteintech, 67932-1-Ig, SCAMP3 Monoclonal antibody

Size: 20ul / 150ul The SCAMP3 (67932-1-Ig) by Proteintech is a Monoclonal antibody targeting SCAMP3 in WB, IF/ICC, ELISA applications with reactivity to Human, rat, mouse samples 67932-1-Ig targets SCAMP3 in WB, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells, LNCaP cells, A549 cells, Hela cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: Human, rat, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26073 Product name: Recombinant human SCAMP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-96 aa of BC000161 Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT Predict reactive species Full Name: secretory carrier membrane protein 3 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC000161 Gene Symbol: SCAMP3 Gene ID (NCBI): 10067 RRID: AB_2918684 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14828 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.