Iright
BRAND / VENDOR: Proteintech

Proteintech, 67942-1-Ig, NAT1 Monoclonal antibody

CATALOG NUMBER: 67942-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NAT1 (67942-1-Ig) by Proteintech is a Monoclonal antibody targeting NAT1 in WB, ELISA applications with reactivity to Human samples 67942-1-Ig targets NAT1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, Caco-2 cells, PC-3 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6280 Product name: Recombinant human NAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-290 aa of BC047666 Sequence: MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI Predict reactive species Full Name: N-acetyltransferase 1 (arylamine N-acetyltransferase) Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC047666 Gene Symbol: NAT1 Gene ID (NCBI): 9 RRID: AB_2918694 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P18440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924