Iright
BRAND / VENDOR: Proteintech

Proteintech, 67947-1-Ig, ACF1 Monoclonal antibody

CATALOG NUMBER: 67947-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACF1 (67947-1-Ig) by Proteintech is a Monoclonal antibody targeting ACF1 in WB, ELISA applications with reactivity to human samples 67947-1-Ig targets ACF1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:5000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30607 Product name: Recombinant human ACF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_013448 Sequence: MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALESEKKARQNLQSFPEPLIIPVLYLTSLTHRSRLHEICDDIFAYVKDRYFVEETVEVIRNNGARLQCRILEVLPPSHQNGFANGHVNSVDGETIIISDSDDSETQSCSFQNGKKKDAIDPLLFKYKVQPTKKE Predict reactive species Full Name: bromodomain adjacent to zinc finger domain, 1A Calculated Molecular Weight: 179 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: NM_013448 Gene Symbol: BAZ1A Gene ID (NCBI): 11177 RRID: AB_2918699 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRL2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924