Proteintech, 67955-1-Ig, ABCC5 Monoclonal antibody

Size: 20ul / 150ul The ABCC5 (67955-1-Ig) by Proteintech is a Monoclonal antibody targeting ABCC5 in WB, ELISA applications with reactivity to Human, Rat samples 67955-1-Ig targets ABCC5 in WB, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: HepG2 cells, U2OS cells, HEK-293 cells, HeLa cells, K-562 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ABCC5, also named as MOAT-C, pABC11, SMRP, and MRP5, belongs to the ABC transporter superfamily, ABCC family, and Conjugate transporter (TC 3.A.1.208) subfamily. ABCC5 acts as a multispecific organic anion pump that can transport nucleotide analogs. ABCC5 functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that ABCC5 provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl) adenine. ABCC5 may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Since it is glycosylated, the apparent molecular weight of ABCC5 could be variable, ranging from 161 kDa to 200 kDa (PMID: 10893247; PMID: 15897250; PMID: 31338999). Specification Tested Reactivity: Human, Rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31674 Product name: Recombinant human ABCC5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of NM_005688 Sequence: MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 5 Calculated Molecular Weight: 161 kDa Observed Molecular Weight: 180-200kDa GenBank Accession Number: NM_005688 Gene Symbol: ABCC5 Gene ID (NCBI): 10057 RRID: AB_2918706 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.