Iright
BRAND / VENDOR: Proteintech

Proteintech, 67961-1-Ig, CCT6B Monoclonal antibody

CATALOG NUMBER: 67961-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCT6B (67961-1-Ig) by Proteintech is a Monoclonal antibody targeting CCT6B in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67961-1-Ig targets CCT6B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, NIH/3T3 cells, HSC-T6 cells, HEK-293 cells, K-562 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information CCT6B, also named as CCT-zeta-2, TCP-1-zeta-like, CCT-zeta-like, Testis-specific Tcp20 and Testis-specific protein TSA303, belongs to the TCP-1 chaperonin family. CCT6B is a molecular chaperone which assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin. CCT6B has 3 isoforms with the molecular mass of 53-58 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31295 Product name: Recombinant human CCT6B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 231-530 aa of BC027591 Sequence: LICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLVYEYTLGEEKFTFIEECVNPCSVTLLVKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAEALVTYKNSIKGRARLGVQAFADALLIIPKVLAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAADAGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK Predict reactive species Full Name: chaperonin containing TCP1, subunit 6B (zeta 2) Calculated Molecular Weight: 530 aa, 58 kDa Observed Molecular Weight: 53-58 kDa GenBank Accession Number: BC027591 Gene Symbol: CCT6B Gene ID (NCBI): 10693 RRID: AB_2918712 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92526 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924