Proteintech, 67962-1-Ig, IPO5 Monoclonal antibody

Size: 20ul / 150ul The IPO5 (67962-1-Ig) by Proteintech is a Monoclonal antibody targeting IPO5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67962-1-Ig targets IPO5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IPO5 is a member of the importin beta family. Structurally, the protein adopts the shape of a right-hand solenoid and is composed of 24 HEAT repeats. IPO5 facilitates cytoplasmic polyadenylation element-binding protein CPEB3 translocation by binding to the RRM1 motif of CPEB3 in neurons. NMDAR signaling increases RanBP1 expression and reduces the level of cytoplasmic GTP-bound Ran. These changes enhance CPEB3-IPO5 interaction, which consequently accelerates the nuclear import of CPEB3 and promotes its nuclear function. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30955 Product name: Recombinant human IPO5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-150 aa of BC001497 Sequence: DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA Predict reactive species Full Name: importin 5 Observed Molecular Weight: 124 kDa GenBank Accession Number: BC001497 Gene Symbol: IPO5 Gene ID (NCBI): 3843 RRID: AB_2918713 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00410 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.