Proteintech, 67965-1-Ig, MFSD2 Monoclonal antibody

Size: 20ul / 150ul The MFSD2 (67965-1-Ig) by Proteintech is a Monoclonal antibody targeting MFSD2 in WB, ELISA applications with reactivity to human, mouse samples 67965-1-Ig targets MFSD2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MFSD2, also named as MFSD2A, belongs to a large family of presumptive carbohydrate transporters with 10-12 membrane-spanning domains, is located at chromosomal position 1p34.2, and is conserved in evolution. It plays a role in thermogenesis via beta-adrenergic signaling pathway. It may be the main plasma membrane tunicamycin transporter. MFSD2 has three isoforms with MW 50 kDa and 59-60 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31028 Product name: Recombinant human MFSD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 453-530 aa of BC092414 Sequence: AGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL Predict reactive species Full Name: major facilitator superfamily domain containing 2 Calculated Molecular Weight: 543 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC092414 Gene Symbol: MFSD2 Gene ID (NCBI): 84879 RRID: AB_2918716 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NA29 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.