Iright
BRAND / VENDOR: Proteintech

Proteintech, 67967-1-Ig, HADHB Monoclonal antibody

CATALOG NUMBER: 67967-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HADHB (67967-1-Ig) by Proteintech is a Monoclonal antibody targeting HADHB in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67967-1-Ig targets HADHB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: LNCaP cells, HepG2 cells, pig heart tissue, Hela cells, HEK-293 cells, Jurkat cells, Rabbit heart tissues, Rat heart tissues, Mouse heart tissues Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HADHB, also named as TP- beta, Acetyl-CoA acyltransferase and Beta-ketothiolase, is a mitochondrial trifunctional enzyme subunit beta. Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta/HADHB described here bears the 3-ketoacyl-CoA thiolase activity. HADHB has 2 isoforms produced by alternative splicing with the MW of 49 kDa and 51 kDa. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30315 Product name: Recombinant human HADHB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 34-262 aa of BC017564 Sequence: RAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLL Predict reactive species Full Name: hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC017564 Gene Symbol: HADHB Gene ID (NCBI): 3032 RRID: AB_2918718 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P55084 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924