Iright
BRAND / VENDOR: Proteintech

Proteintech, 67983-1-Ig, NFIX Monoclonal antibody

CATALOG NUMBER: 67983-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NFIX (67983-1-Ig) by Proteintech is a Monoclonal antibody targeting NFIX in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples 67983-1-Ig targets NFIX in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, A549 cells, HeLa cells, rat testis tissue, rat brain tissue, rabbit brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information NFIX, also named CTF, belongs to the CTF/NF-I family. NFIX recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. NFIX is individually capable of activating transcription and replication. Specification Tested Reactivity: Human, mouse, rat, pig, rabbit Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31447 Product name: Recombinant human NFIX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-400 aa of NM_001271043 Sequence: ADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSL Predict reactive species Full Name: nuclear factor I/X (CCAAT-binding transcription factor) Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 45kDa, 50kDa GenBank Accession Number: NM_001271043 Gene Symbol: NFIX Gene ID (NCBI): 4784 RRID: AB_2918732 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14938 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924