Proteintech, 67987-1-Ig, IFT81 Monoclonal antibody

Size: 20ul / 150ul The IFT81 (67987-1-Ig) by Proteintech is a Monoclonal antibody targeting IFT81 in WB, IF/ICC, ELISA applications with reactivity to Human, Rat, Mouse, Rabbit, canine samples 67987-1-Ig targets IFT81 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Rat, Mouse, Rabbit, canine samples. Tested Applications Positive WB detected in: HEK-293 cells, rabbit brain tissue, NCCIT cells, hTERT-RPE1 cells, MDCK cells, Human testis tissue, Rat testis tissue, Mouse testis tissue Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT particles are multi-subunit complexes of proteins that functions to move non-membrane-bound particles from the cell body to the tip of cilium or flagellum, then return them to the cell body. Transport towards the ciliary tip is regulated by the IFT complex B (IFT-B), consisting of at least 15 IFT proteins, in association with kinesin motors, whereas transport from the ciliary tip back to the base is executed by a dynein motor in association with the IFT complex A (IFT-A), currently known to be composed of six IFT proteins. IFT81 is a subunit of IFT complex B.It may play a role in development of the testis and spermatogenesis. There are some isoforms of IFT81 with 73-78 kDa and 43-50 kDa. Specification Tested Reactivity: Human, Rat, Mouse, Rabbit, canine Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31629 Product name: Recombinant human IFT81 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 550-676 aa of BC029349 Sequence: VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL Predict reactive species Full Name: intraflagellar transport 81 homolog (Chlamydomonas) Calculated Molecular Weight: 676 aa, 80 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC029349 Gene Symbol: IFT81 Gene ID (NCBI): 28981 RRID: AB_2918736 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8WYA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.