Proteintech, 67994-1-Ig, SOX1 Monoclonal antibody

Size: 20ul / 150ul The SOX1 (67994-1-Ig) by Proteintech is a Monoclonal antibody targeting SOX1 in WB, ELISA applications with reactivity to Human, Mouse samples 67994-1-Ig targets SOX1 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HUVEC cells, HaCaT cells, COLO 320 cells, NCCIT cells, ATDC-5 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, Mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31118 Product name: Recombinant human SOX1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 318-391 aa of NM_005986 Sequence: VKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI Predict reactive species Full Name: SRY (sex determining region Y)-box 1 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: NM_005986 Gene Symbol: SOX1 Gene ID (NCBI): 6656 RRID: AB_2918743 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00570 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.