Proteintech, 68006-1-Ig, TGM2 Monoclonal antibody

Size: 20ul / 150ul The TGM2 (68006-1-Ig) by Proteintech is a Monoclonal antibody targeting TGM2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 68006-1-Ig targets TGM2 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue, HUVEC cells, HepG2 cells, K-562 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Transglutaminase 2 (TGM2) is a ubiquitous and multifunctional calcium-dependent enzyme belonging to the transglutaminase family. It is best known for its canonical activity of catalyzing the cross-linking of proteins by forming stable ε-(γ-glutamyl)lysine isopeptide bonds, which contributes to extracellular matrix stabilization and wound healing. Beyond this, TGM2 exhibits GTPase activity, allowing it to function as a signaling G-protein in intracellular processes. It is implicated in a wide range of physiological functions, including cell adhesion, proliferation, and apoptosis, as well as pathological conditions such as celiac disease, fibrosis, neurodegenerative disorders, and cancer metastasis, where its dysregulated expression often contributes to disease progression. Specification Tested Reactivity: human Cited Reactivity: human, mouse, hamster Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7462 Product name: Recombinant human TGM2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-349 aa of BC003551 Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQP Predict reactive species Full Name: transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) Calculated Molecular Weight: 77 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC003551 Gene Symbol: TGM2 Gene ID (NCBI): 7052 ENSEMBL Gene ID: ENSG00000198959 RRID: AB_2918753 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21980 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.