Iright
BRAND / VENDOR: Proteintech

Proteintech, 68012-1-Ig, GATA4 Monoclonal antibody

CATALOG NUMBER: 68012-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GATA4 (68012-1-Ig) by Proteintech is a Monoclonal antibody targeting GATA4 in WB, ELISA applications with reactivity to Human, Mouse samples 68012-1-Ig targets GATA4 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: PC-3 cells, HEK-293 cells, HepG2 cells, NCCIT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information GATA4 is a transcriptional activator. GATA4 binds to the consensus sequence 5'-AGATAG-3'. GATA4 acts as a transcriptional activator of ANF in cooperation with NKX2-5. Mutation of GATA4 will cause the atrial septal defect type 2 (ASD2). Specification Tested Reactivity: Human, Mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30392 Product name: Recombinant human GATA4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-442 aa of BC101580 Sequence: RLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA Predict reactive species Full Name: GATA binding protein 4 Calculated Molecular Weight: 442 aa, 45 kDa Observed Molecular Weight: 44,45 kDa GenBank Accession Number: BC101580 Gene Symbol: GATA4 Gene ID (NCBI): 2626 RRID: AB_2918759 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P43694 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924