Iright
BRAND / VENDOR: Proteintech

Proteintech, 68025-1-Ig, SLC39A3 Monoclonal antibody

CATALOG NUMBER: 68025-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC39A3 (68025-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC39A3 in WB, ELISA applications with reactivity to Human samples 68025-1-Ig targets SLC39A3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: unboiled HepG2 cells, HepG2 cells, 37°C incubated A549 cells, LNCaP cells, Jurkat cells, K-562 cells, unboiled A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10400 Background Information SLC39A3, also named as ZIP3, belongs to the ZIP transporter (TC 2.A.5) family. SLC39A3 is a Zn importer that acts as a zinc-influx transporter. SLC39A3 is highly expressed in a cell-type-specific manner in ovaries, testes, and the developing nervous system with limited expression in the small intestinal crypt cells, kidney glomerulus, and discrete regions of the liver. SLC39A3 is also expressed in highly specialized, hormonally responsive secretory tissues, such as the pancreas, prostate, and mammary gland (PMID: 19458277). SLC39A3 has 2 isoforms with the molecular mass of 11 and 34 kDa. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14289 Product name: Recombinant human SLC39A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-180 aa of BC005869 Sequence: FMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 3 Calculated Molecular Weight: 314 aa, 34 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC005869 Gene Symbol: SLC39A3 Gene ID (NCBI): 29985 RRID: AB_2918769 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BRY0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924