Iright
BRAND / VENDOR: Proteintech

Proteintech, 68031-1-Ig, RAB9B Monoclonal antibody

CATALOG NUMBER: 68031-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAB9B (68031-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB9B in WB, ELISA applications with reactivity to Human samples 68031-1-Ig targets RAB9B in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, LNCaP cells, HeLa cells, Jurkat cells, MOLT-4 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information RAB9B, also named as RAB9L, is involved in the transport of proteins between the endosomes and the trans Golgi network. RAB9B belongs to the Ras-related superfamily of guanine nucleotide binding proteins, which includes the Ral/Rec, Rap, R-Ras, and Rho/Rab subfamilies Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12862 Product name: Recombinant human RAB9B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC093756 Sequence: MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC Predict reactive species Full Name: RAB9B, member RAS oncogene family Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC093756 Gene Symbol: RAB9B Gene ID (NCBI): 51209 RRID: AB_2918773 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NP90 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924