Proteintech, 68038-1-Ig, ZFP36L1 Monoclonal antibody

Size: 20ul / 150ul The ZFP36L1 (68038-1-Ig) by Proteintech is a Monoclonal antibody targeting ZFP36L1 in WB, IF/ICC, ELISA applications with reactivity to Human, Rat samples 68038-1-Ig targets ZFP36L1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: HUVEC cells, HSC-T6 cells, PC-12 cells, U2OS cells, A549 cells, HeLa cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information As a member of the Tristetraprolin (TTP) RNA binding protein family, ZFP36L1 regulate gene expression post-transcriptionally by promoting mRNA decay. In mammals, ZFP36L1 and its family members have been shown to regulate development, cell diferentiation, cell cycle, apoptosis and anti-cancer capability by targeting an extensive overlapping repertoire of mRNAs. Specification Tested Reactivity: Human, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30469 Product name: Recombinant human ZFP36L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-338 aa of BC018340 Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD Predict reactive species Full Name: zinc finger protein 36, C3H type-like 1 Calculated Molecular Weight: 338 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC018340 Gene Symbol: ZFP36L1 Gene ID (NCBI): 677 RRID: AB_2918780 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q07352 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.