Iright
BRAND / VENDOR: Proteintech

Proteintech, 68043-1-Ig, Synaptotagmin-1 Monoclonal antibody

CATALOG NUMBER: 68043-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Synaptotagmin-1 (68043-1-Ig) by Proteintech is a Monoclonal antibody targeting Synaptotagmin-1 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit, Chicken samples 68043-1-Ig targets Synaptotagmin-1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit, Chicken samples. Tested Applications Positive WB detected in: pig brain tissue, rat cerebellum tissue, mouse cerebellum tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue, rabbit cerebellum tissue Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Background Information The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114). Specification Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit, Chicken Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6071 Product name: Recombinant human SYT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 97-422 aa of BC058917 Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK Predict reactive species Full Name: synaptotagmin I Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC058917 Gene Symbol: Synaptotagmin-1 Gene ID (NCBI): 6857 RRID: AB_2918785 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P21579 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924