Iright
BRAND / VENDOR: Proteintech

Proteintech, 68046-1-Ig, SNCB Monoclonal antibody

CATALOG NUMBER: 68046-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SNCB (68046-1-Ig) by Proteintech is a Monoclonal antibody targeting SNCB in WB, IF-P, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit, chicken samples 68046-1-Ig targets SNCB in WB, IF-P, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit, chicken samples. Tested Applications Positive WB detected in: pig brain tissue, rabbit brain, rat brain, mouse brain, chicken brain Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: Human, mouse, rat, pig, rabbit, chicken Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0772 Product name: Recombinant human SNCB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC002902 Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA Predict reactive species Full Name: synuclein, beta Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC002902 Gene Symbol: SNCB Gene ID (NCBI): 6620 RRID: AB_2918788 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q16143 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924