Proteintech, 68048-1-Ig, TPPP Monoclonal antibody

Size: 20ul / 150ul The TPPP (68048-1-Ig) by Proteintech is a Monoclonal antibody targeting TPPP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, chicken samples 68048-1-Ig targets TPPP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples. Tested Applications Positive WB detected in: pig brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, SH-SY5Y cells, rabbit brain, rat brain, mouse brain, chicken brain Positive IHC detected in: human lung tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TPPP, also named as TPPP1, P24 and P25, belongs to the TPPP family. TPPP promotes in vitro the polymerization of tubulin into double-walled tubules and polymorphic aggregates or bundled stabilized microtubules blocks. When overexpressed, TPPP inhibits mitotic spindle assembly and nuclear envelope breakdown, apparently without affecting other cellular events. Specification Tested Reactivity: human, mouse, rat, pig, rabbit, chicken Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19046 Product name: Recombinant human TPPP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-95 aa of BC131506 Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTD Predict reactive species Full Name: tubulin polymerization promoting protein Calculated Molecular Weight: 219 aa, 24 kDa Observed Molecular Weight: 24-29 kDa GenBank Accession Number: BC131506 Gene Symbol: TPPP Gene ID (NCBI): 11076 RRID: AB_2918790 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O94811 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.