Iright
BRAND / VENDOR: Proteintech

Proteintech, 68052-1-Ig, RAB3A Monoclonal antibody

CATALOG NUMBER: 68052-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAB3A (68052-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB3A in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, chicken samples 68052-1-Ig targets RAB3A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples. Tested Applications Positive WB detected in: pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue, rabbit cerebellum tissue, rat cerebellum tissue Positive IHC detected in: rat testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Rab3A is a small G-protein of the Rab family, that is implicated in vesicle fusion and regulated secretion, particularly in neurotransmitter release. Rab3 subfamily small G proteins (Rab3A, Rab3B, Rab3C, and Rab3D) control the regulated exocytosis in neuronal/secretory cells. Rab3A is the most abundant Rab GTPase in brain, where it is associated with synaptic vesicles. Rab3a is believed to modulate secretion efficiency by stimulating vesicle recruitment to sites of exocytosis and/ or by recruiting regulatory molecules to the docking/ fusion machinery. Specification Tested Reactivity: human, mouse, rat, pig, rabbit, chicken Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8148 Product name: Recombinant human RAB3A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-220 aa of BC011782 Sequence: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC Predict reactive species Full Name: RAB3A, member RAS oncogene family Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC011782 Gene Symbol: RAB3A Gene ID (NCBI): 5864 RRID: AB_2918794 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20336 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924