Iright
BRAND / VENDOR: Proteintech

Proteintech, 68057-1-Ig, RFX1 Monoclonal antibody

CATALOG NUMBER: 68057-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RFX1 (68057-1-Ig) by Proteintech is a Monoclonal antibody targeting RFX1 in WB, ELISA applications with reactivity to Human, Mouse samples 68057-1-Ig targets RFX1 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells, U2OS cells, K-562 cells, A549 cells, MCF-7 cells, LnCaP cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information RFX1, also named as MHC class II regulatory factor RFX1, is a 979 amino acid protein which contains 1 RFX-type winged-helix DNA-binding domain and belongs to the RFX family. RFX1 can binds DNA as a homodimer and heterodimerizes with RFX2 and RFX3. RFX1 as a regulatory factor is essential for MHC class II genes expression. RFX1 protein is modified after translation and its molecular weight could be migrate to 130-140 kDa (PMID: 20189986 ). Specification Tested Reactivity: Human, Mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25442 Product name: Recombinant human RFX1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 62-289 aa of BC049826 Sequence: QPQAQPPGGQKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQGTQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPH Predict reactive species Full Name: regulatory factor X, 1 (influences HLA class II expression) Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC049826 Gene Symbol: RFX1 Gene ID (NCBI): 5989 RRID: AB_2918798 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P22670 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924