Iright
BRAND / VENDOR: Proteintech

Proteintech, 68059-1-Ig, HSPB11 Monoclonal antibody

CATALOG NUMBER: 68059-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSPB11 (68059-1-Ig) by Proteintech is a Monoclonal antibody targeting HSPB11 in WB, ELISA applications with reactivity to human samples 68059-1-Ig targets HSPB11 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCCIT cells, HeLa cells, LNCaP cells, HEK-293 cells, T-47D cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information HSPB11 (Heat shock protein beta-11), also known as IFT25, was originally identified as a small heat shock protein. Recently it has been identified as a component of IFT complex B. It has been demonstrated that IFT25 is not required for ciliary assembly but is required for proper Hedgehog signaling, which in mammals occurs within cilia. Cilia lacking IFT25 have defects in the signal-dependent transport of multiple Hedgehog components and fail to activate the pathway upon stimulation. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8804 Product name: Recombinant human HSPB11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-144 aa of BC005245 Sequence: MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS Predict reactive species Full Name: heat shock protein family B (small), member 11 Calculated Molecular Weight: 144 aa, 16 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC005245 Gene Symbol: HSPB11 Gene ID (NCBI): 51668 RRID: AB_2918800 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y547 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924