Proteintech, 68061-1-Ig, NSF Monoclonal antibody

Size: 20ul / 150ul The NSF (68061-1-Ig) by Proteintech is a Monoclonal antibody targeting NSF in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, chicken samples 68061-1-Ig targets NSF in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples. Tested Applications Positive WB detected in: pig brain tissue, SH-SY5Y cells, PC-12 cells, HEK-293 cells, Rabbit brain tissue, Rat brain tissue, Mouse brain tissue, Chicken brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)-P: IF-P : 1:300-1:1200 Specification Tested Reactivity: human, mouse, rat, pig, rabbit, chicken Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15422 Product name: Recombinant human NSF protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 394-744 aa of BC030613 Sequence: EIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD Predict reactive species Full Name: N-ethylmaleimide-sensitive factor Calculated Molecular Weight: 744 aa, 83 kDa Observed Molecular Weight: 70-83 kDa GenBank Accession Number: BC030613 Gene Symbol: NSF Gene ID (NCBI): 4905 RRID: AB_2918802 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P46459 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.