Iright
BRAND / VENDOR: Proteintech

Proteintech, 68087-1-Ig, PYCRL Monoclonal antibody

CATALOG NUMBER: 68087-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PYCRL (68087-1-Ig) by Proteintech is a Monoclonal antibody targeting PYCRL in WB, IF/ICC, ELISA applications with reactivity to human, rabbit samples 68087-1-Ig targets PYCRL in WB, IF/ICC, ELISA applications and shows reactivity with human, rabbit samples. Tested Applications Positive WB detected in: HeLa cells, rabbit kidney tissue, HEK293 cells, LNCaP cells, MCF-7 cells, U2OS cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, rabbit Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31938 Product name: Recombinant human PYCRL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 136-274 aa of BC007993 Sequence: IVMARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK Predict reactive species Full Name: pyrroline-5-carboxylate reductase-like Calculated Molecular Weight: 274 aa, 29 kDa Observed Molecular Weight: 26-29 kDa GenBank Accession Number: BC007993 Gene Symbol: PYCRL Gene ID (NCBI): 65263 RRID: AB_2918824 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q53H96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924