Iright
BRAND / VENDOR: Proteintech

Proteintech, 68088-1-Ig, mCherry Monoclonal antibody

CATALOG NUMBER: 68088-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 150ul The mCherry (68088-1-Ig) by Proteintech is a Monoclonal antibody targeting mCherry in WB, IF/ICC, ELISA applications with reactivity to recombinant protein samples 68088-1-Ig targets mCherry in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with recombinant protein samples. Tested Applications Positive WB detected in: Transfected HEK-293 cells Positive IF/ICC detected in: Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information mCherry is a fluorophore (a fluorescent protein) used in biotechnology as a tracer to follow the flow of fluids, as a marker when tagged to molecules and cell components. mCherry is the second generation monomeric red fluorescent protein that have improved brightness and photostability. mCherry and the majority of red fluorescent proteins derive from a protein isolated from Discosoma sp. mCherry is a monomeric fluorescent construct with peak absorption/emission at 587 nm and 610 nm, respectively. Specification Tested Reactivity: recombinant protein Cited Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species Full Name: mCherry Calculated Molecular Weight: 27 kDa RRID: AB_2918825 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924