Iright
BRAND / VENDOR: Proteintech

Proteintech, 68095-1-Ig, SNRPB2 Monoclonal antibody

CATALOG NUMBER: 68095-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SNRPB2 (68095-1-Ig) by Proteintech is a Monoclonal antibody targeting SNRPB2 in WB, FC (Intra), ELISA applications with reactivity to human samples 68095-1-Ig targets SNRPB2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information U2 small nuclear ribonucleoprotein B''(SNRPB2) is part of the U2 RNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. Only in presence of the U2A' protein, SNRPB2 binds stem loop IV of U2 snRNA. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5540 Product name: Recombinant human SNRPB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC036737 Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK Predict reactive species Full Name: small nuclear ribonucleoprotein polypeptide B'' Calculated Molecular Weight: 225 aa, 26, 5 kDa Observed Molecular Weight: 25-31 kDa GenBank Accession Number: BC036737 Gene Symbol: SNRPB2 Gene ID (NCBI): 6629 RRID: AB_2918832 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08579 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924