Proteintech, 68096-1-Ig, Syntenin-1 Monoclonal antibody

Size: 20ul / 150ul The Syntenin-1 (68096-1-Ig) by Proteintech is a Monoclonal antibody targeting Syntenin-1 in WB, IHC, ELISA applications with reactivity to Human samples 68096-1-Ig targets Syntenin-1 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, HEK-293 cell, Jurkat cells Positive IHC detected in: human malignant melanoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18078 Product name: Recombinant human SDCBP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 12-139 aa of BC113674 Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ Predict reactive species Full Name: syndecan binding protein (syntenin) Calculated Molecular Weight: 298 aa, 32 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC113674 Gene Symbol: Syntenin-1 Gene ID (NCBI): 6386 RRID: AB_2918833 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00560 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.