Iright
BRAND / VENDOR: Proteintech

Proteintech, 68110-1-Ig, RPL12 Monoclonal antibody

CATALOG NUMBER: 68110-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RPL12 (68110-1-Ig) by Proteintech is a Monoclonal antibody targeting RPL12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 68110-1-Ig targets RPL12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: mouse brain tissue, human endometrial cancer tissue, human placenta tissue, mouse stomach tissue, rat brain tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:8000-1:32000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6580 Product name: Recombinant human RPL12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-165 aa of BC050644 Sequence: MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS Predict reactive species Full Name: ribosomal protein L12 Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC050644 Gene Symbol: RPL12 Gene ID (NCBI): 6136 RRID: AB_2923639 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P30050 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924