Iright
BRAND / VENDOR: Proteintech

Proteintech, 68134-1-Ig, P30 of ASFV Monoclonal antibody

CATALOG NUMBER: 68134-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The P30 of ASFV (68134-1-Ig) by Proteintech is a Monoclonal antibody targeting P30 of ASFV in WB, ELISA applications with reactivity to asfv samples 68134-1-Ig targets P30 of ASFV in WB, ELISA applications and shows reactivity with asfv samples. Tested Applications Positive WB detected in: Ag31446 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: asfv Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31446 Product name: Recombinant asfv P30 of ASFV protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of M96354 Sequence: MDFILNISMKMEVIFKTDLRSSSQVVFHAGSLYNWFSVEIINSGRIVTTAIKTLLSTVKYDIVKSAHIYAGQGYTEHQAQEEWNMILHVLFEEETESSASSESIHEKNDNETNECTSSFETLFEQEPSSEEPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIHGTPLKEEEKEVVRLMVIKLLKKNKLLSHLHLMF Predict reactive species Full Name: Phosphoprotein p30 Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: M96354 Gene Symbol: P30 of ASFV Gene ID (NCBI): 22220322 RRID: AB_2923661 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P34204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924