Iright
BRAND / VENDOR: Proteintech

Proteintech, 68137-1-Ig, TSPO/PBR Monoclonal antibody

CATALOG NUMBER: 68137-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPO/PBR (68137-1-Ig) by Proteintech is a Monoclonal antibody targeting TSPO/PBR in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68137-1-Ig targets TSPO/PBR in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, LNCaP cells, Jurkat cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TSPO, also named Peripheral-type benzodiazepine receptor (PBR), encodes the translocator protein, belonging to tryptophan-rich sensory protein family. The protein is mainly localized in the outer mitochondrial membrane and expressed in steroid-synthesizing tissues (PMID:32881658, PMID:1326278). TSPO is involved in the translocation of cholesterol from the outer to inner mitochondrial membrane (PMID:21119734). In response to injury, TSPO has a upregulated expression in the peripheral nervous system (PMID:32423330, PMID:23251719). TSPO is also as a biomarker in a non-invasive procedure including detecting the inflammation in the heart and atherosclerotic plaques (PMID:24402571). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7475 Product name: Recombinant human TSPO protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-169 aa of BC001110 Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE Predict reactive species Full Name: translocator protein (18kDa) Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC001110 Gene Symbol: TSPO Gene ID (NCBI): 706 RRID: AB_2923664 Conjugate: Unconjugated Form: Liquid Purification Method: Caprylic acid/ammonium sulfate precipitation UNIPROT ID: P30536 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924